PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01250.1.g00060.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 219aa    MW: 24338 Da    PI: 7.3422
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01250.1.g00060.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.31.1e-1782136256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++keq + Le+ F++++ +s +++ eLA++++Lt rqV vWFqNrRa+ k
  Zpz_sc01250.1.g00060.1.sm.mk  82 RKKLQLSKEQATLLEDTFRSHNILSYAQKHELARRVNLTPRQVEVWFQNRRARTK 136
                                   678899***********************************************98 PP

2HD-ZIP_I/II108.45.2e-3582169188
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk++lskeq++lLE++F++++ L+  +K+elar+++l+prqv+vWFqnrRARtk+kq+E+d e Lkr++++l+ en+rL+
  Zpz_sc01250.1.g00060.1.sm.mk  82 RKKLQLSKEQATLLEDTFRSHNILSYAQKHELARRVNLTPRQVEVWFQNRRARTKLKQTEVDREILKRCCESLTVENQRLK 162
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLr 88 
                                   +e   L+
  Zpz_sc01250.1.g00060.1.sm.mk 163 HELVGLQ 169
                                   *998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-1866137IPR009057Homeodomain-like
SuperFamilySSF466893.17E-1872139IPR009057Homeodomain-like
PROSITE profilePS5007117.03878138IPR001356Homeobox domain
SMARTSM003892.5E-1280142IPR001356Homeobox domain
PfamPF000466.4E-1582136IPR001356Homeobox domain
CDDcd000862.38E-1282139No hitNo description
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PfamPF021835.1E-7138168IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.7E-10138182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MEEEDLRAWL GLGIGGGGEG GCSPSRSHGE RWSSVQFDKQ DEMSGCGYEQ AENKKSDDKG  60
RTRKRCPSPS EEEDDGGDGG ARKKLQLSKE QATLLEDTFR SHNILSYAQK HELARRVNLT  120
PRQVEVWFQN RRARTKLKQT EVDREILKRC CESLTVENQR LKHELVGLQR SGAVAGLYVV  180
DNQFPRAAPA DTVSVCPSCE KVTLTSVGDT SNKSSSYSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966133.19e-79PREDICTED: homeobox-leucine zipper protein HOX18-like
SwissprotQ5Z6F61e-56HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLK3XZ801e-78K3XZ80_SETIT; Uncharacterized protein
STRINGSi007238m3e-78(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-40homeobox from Arabidopsis thaliana